Lineage for d1f3dl1 (1f3d L:1-107)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219335Species Catalytic Fab 4B2, (mouse), kappa L chain [48900] (1 PDB entry)
  8. 219339Domain d1f3dl1: 1f3d L:1-107 [20460]
    Other proteins in same PDB: d1f3dh2, d1f3dj2, d1f3dk2, d1f3dl2

Details for d1f3dl1

PDB Entry: 1f3d (more details), 1.87 Å

PDB Description: catalytic antibody 4b2 in complex with its amidinium hapten.

SCOP Domain Sequences for d1f3dl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3dl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Catalytic Fab 4B2, (mouse), kappa L chain}
dvlmtqtplslpvslgdqvsiscrssqsifhsdgktylewhlqkpgqspklliykvskrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleik

SCOP Domain Coordinates for d1f3dl1:

Click to download the PDB-style file with coordinates for d1f3dl1.
(The format of our PDB-style files is described here.)

Timeline for d1f3dl1: