| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
| Protein Shikimate 5-dehydrogenase AroE [89538] (6 species) |
| Species Aquifex aeolicus [TaxId:63363] [225281] (3 PDB entries) |
| Domain d2hk8b2: 2hk8 B:106-266 [204597] Other proteins in same PDB: d2hk8a1, d2hk8b1, d2hk8c1, d2hk8d1, d2hk8e1, d2hk8f1, d2hk8g1, d2hk8h1 automated match to d1nvta1 |
PDB Entry: 2hk8 (more details), 2.35 Å
SCOPe Domain Sequences for d2hk8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hk8b2 c.2.1.7 (B:106-266) Shikimate 5-dehydrogenase AroE {Aquifex aeolicus [TaxId: 63363]}
dwigflkslkslipevkeksilvlgaggasraviyalvkegakvflwnrtkekaiklaqk
fplevvnspeevidkvqvivnttsvglkdedpeifnydlikkdhvvvdiiyketkllkka
kekgaklldglpmllwqgieafkiwngcevpysvaersvrd
Timeline for d2hk8b2: