Lineage for d2hk7b1 (2hk7 B:1-105)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890580Family c.58.1.5: Shikimate dehydrogenase-like [82336] (3 proteins)
  6. 2890589Protein Shikimate 5-dehydrogenase AroE [89584] (6 species)
  7. 2890590Species Aquifex aeolicus [TaxId:63363] [225280] (3 PDB entries)
  8. 2890600Domain d2hk7b1: 2hk7 B:1-105 [204592]
    Other proteins in same PDB: d2hk7a2, d2hk7b2
    automated match to d1nvta2
    complexed with hg

Details for d2hk7b1

PDB Entry: 2hk7 (more details), 2.5 Å

PDB Description: Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with mercury at 2.5 angstrom resolution
PDB Compounds: (B:) Shikimate dehydrogenase

SCOPe Domain Sequences for d2hk7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hk7b1 c.58.1.5 (B:1-105) Shikimate 5-dehydrogenase AroE {Aquifex aeolicus [TaxId: 63363]}
minaqtqlygvigfpvkhslspvfqnaliryaglnavylafeinpeelkkafegfkalkv
kginvtvpfkeeiiplldyvedtakeigavntvkfengkaygynt

SCOPe Domain Coordinates for d2hk7b1:

Click to download the PDB-style file with coordinates for d2hk7b1.
(The format of our PDB-style files is described here.)

Timeline for d2hk7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hk7b2