Lineage for d2hk7a2 (2hk7 A:106-269)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349489Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 1349728Protein Shikimate 5-dehydrogenase AroE [89538] (6 species)
  7. 1349729Species Aquifex aeolicus [TaxId:63363] [225281] (3 PDB entries)
  8. 1349742Domain d2hk7a2: 2hk7 A:106-269 [204591]
    Other proteins in same PDB: d2hk7a1, d2hk7b1
    automated match to d1nvta1
    complexed with hg

Details for d2hk7a2

PDB Entry: 2hk7 (more details), 2.5 Å

PDB Description: Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with mercury at 2.5 angstrom resolution
PDB Compounds: (A:) Shikimate dehydrogenase

SCOPe Domain Sequences for d2hk7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hk7a2 c.2.1.7 (A:106-269) Shikimate 5-dehydrogenase AroE {Aquifex aeolicus [TaxId: 63363]}
dwigflkslkslipevkeksilvlgaggasraviyalvkegakvflwnrtkekaiklaqk
fplevvnspeevidkvqvivnttsvglkdedpeifnydlikkdhvvvdiiyketkllkka
kekgaklldglpmllwqgieafkiwngcevpysvaersvrdlrg

SCOPe Domain Coordinates for d2hk7a2:

Click to download the PDB-style file with coordinates for d2hk7a2.
(The format of our PDB-style files is described here.)

Timeline for d2hk7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hk7a1