SCOP 1.59: Domain d1f11d1: 1f11 D:1-113

Lineage for d1f11d1 (1f11 D:1-113)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Anti-Pres2 Fab F124, (mouse), kappa L chain [48899] (1 PDB entry)

8. Domain d1f11d1: 1f11 D:1-113 [20459]
   Other proteins in same PDB: d1f11a2, d1f11b2, d1f11c2, d1f11d2

Details for d1f11d1

PDB Entry: 1f11, 3 Å

PDB Description: f124 fab fragment from a monoclonal anti-pres2 antibody

SCOP Domain Sequences for d1f11d1:

Sequence; same for both SEQRES and ATOM records:

>d1f11d1 b.1.1.1 (D:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-Pres2 Fab F124, (mouse), kappa L chain}
evqlqqsgpelvkpgasvkmsckasgytftdyymkwvkqshgkslewigdinpnnggtgy
nqkfkgkatltvdkssstaymqlnsltsedsavyycandygstygfaywgqgtlvtvsa

Timeline for d1f11d1:

• d1f11d1 first appeared (with stable ids) in SCOP 1.55
  
• d1f11d1 appears in SCOP 1.57
  
• d1f11d1 appears in SCOP 1.61
  
• d1f11d1 appears in the current release, SCOPe 2.08