SCOPe 2.03: Domain d2hjri1: 2hjr I:13-154

Lineage for d2hjri1 (2hjr I:13-154)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Cryptosporidium parvum [TaxId:5807] [225104] (2 PDB entries)

8. Domain d2hjri1: 2hjr I:13-154 [204582]
   Other proteins in same PDB: d2hjra2, d2hjrb2, d2hjrc2, d2hjrd2, d2hjre2, d2hjrf2, d2hjrg2, d2hjrh2, d2hjri2, d2hjrj2, d2hjrk2, d2hjrl2
   automated match to d5ldha1
   complexed with apr, cit

Details for d2hjri1

PDB Entry: 2hjr, 2.2 Å

PDB Description: Crystal Structure of Cryptosporidium parvum malate dehydrogenase

PDB Compounds: (I:) malate dehydrogenase

SCOPe Domain Sequences for d2hjri1:

Sequence; same for both SEQRES and ATOM records:

>d2hjri1 c.2.1.0 (I:13-154) automated matches {Cryptosporidium parvum [TaxId: 5807]}
mrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnhcmaligspakif
gennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgkycpnafvicitn
pldamvyyfkeksgipankvcg

Timeline for d2hjri1:

• d2hjri1 is new in SCOPe 2.03-stable
  
• d2hjri1 appears in SCOPe 2.04
  
• d2hjri1 appears in the current release, SCOPe 2.08