Lineage for d1f11c1 (1f11 C:1-107)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287999Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (23 PDB entries)
  8. 288018Domain d1f11c1: 1f11 C:1-107 [20458]
    Other proteins in same PDB: d1f11a2, d1f11b1, d1f11b2, d1f11c2, d1f11d1, d1f11d2
    part of anti-Pres2 Fab F124

Details for d1f11c1

PDB Entry: 1f11 (more details), 3 Å

PDB Description: f124 fab fragment from a monoclonal anti-pres2 antibody

SCOP Domain Sequences for d1f11c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f11c1 b.1.1.1 (C:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2}
dmvltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyvasnlks
giparfsgsgsgtdftlnihpveeedaatyycqqsnedpftfgsgtkleik

SCOP Domain Coordinates for d1f11c1:

Click to download the PDB-style file with coordinates for d1f11c1.
(The format of our PDB-style files is described here.)

Timeline for d1f11c1: