Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (181 species) not a true protein |
Species Cryptosporidium parvum [TaxId:5807] [225104] (2 PDB entries) |
Domain d2hjrg1: 2hjr G:13-154 [204578] Other proteins in same PDB: d2hjra2, d2hjrb2, d2hjrc2, d2hjrd2, d2hjre2, d2hjrf2, d2hjrg2, d2hjrh2, d2hjri2, d2hjrj2, d2hjrk2, d2hjrl2 automated match to d5ldha1 complexed with apr, cit |
PDB Entry: 2hjr (more details), 2.2 Å
SCOPe Domain Sequences for d2hjrg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hjrg1 c.2.1.0 (G:13-154) automated matches {Cryptosporidium parvum [TaxId: 5807]} mrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnhcmaligspakif gennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgkycpnafvicitn pldamvyyfkeksgipankvcg
Timeline for d2hjrg1: