Lineage for d2hjrg1 (2hjr G:13-154)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846710Species Cryptosporidium parvum [TaxId:5807] [225104] (1 PDB entry)
  8. 2846717Domain d2hjrg1: 2hjr G:13-154 [204578]
    Other proteins in same PDB: d2hjra2, d2hjrb2, d2hjrc2, d2hjrd2, d2hjre2, d2hjrf2, d2hjrg2, d2hjrh2, d2hjri2, d2hjrj2, d2hjrk2, d2hjrl2
    automated match to d5ldha1
    complexed with apr, cit

Details for d2hjrg1

PDB Entry: 2hjr (more details), 2.2 Å

PDB Description: Crystal Structure of Cryptosporidium parvum malate dehydrogenase
PDB Compounds: (G:) malate dehydrogenase

SCOPe Domain Sequences for d2hjrg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hjrg1 c.2.1.0 (G:13-154) automated matches {Cryptosporidium parvum [TaxId: 5807]}
mrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnhcmaligspakif
gennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgkycpnafvicitn
pldamvyyfkeksgipankvcg

SCOPe Domain Coordinates for d2hjrg1:

Click to download the PDB-style file with coordinates for d2hjrg1.
(The format of our PDB-style files is described here.)

Timeline for d2hjrg1: