SCOPe 2.08: Domain d2hiwb1: 2hiw B:248-517

Lineage for d2hiwb1 (2hiw B:248-517)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d2hiwb1: 2hiw B:248-517 [204565]
   Other proteins in same PDB: d2hiwa2, d2hiwb2
   automated match to d1opja_
   complexed with 7mp

Details for d2hiwb1

PDB Entry: 2hiw, 2.2 Å

PDB Description: Crystal Structure of Inactive Conformation Abl Kinase Catalytic Domain Complexed with Type II Inhibitor

PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d2hiwb1:

Sequence; same for both SEQRES and ATOM records:

>d2hiwb1 d.144.1.7 (B:248-517) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaav
mkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqiss
ameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtape
slaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvy
elmracwqwnpsdrpsfaeihqafetmfqe

Timeline for d2hiwb1:

• d2hiwb1 first appeared in SCOPe 2.03, called d2hiwb_
  
• d2hiwb1 appears in SCOPe 2.07