Lineage for d2himb1 (2him B:1-337)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142620Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 2142621Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) (S)
  5. 2142622Family c.88.1.1: Glutaminase/Asparaginase [53775] (4 protein domains)
    automatically mapped to Pfam PF00710
  6. 2142708Protein automated matches [190446] (8 species)
    not a true protein
  7. 2142709Species Escherichia coli [TaxId:562] [225264] (4 PDB entries)
  8. 2142715Domain d2himb1: 2him B:1-337 [204561]
    Other proteins in same PDB: d2himb2, d2himd2
    automated match to d3ntxa_
    complexed with asn, asp, edo

Details for d2himb1

PDB Entry: 2him (more details), 1.82 Å

PDB Description: Crystal Structure and Allosteric Regulation of the Cytoplasmic Escherichia coli L-Asparaginase I
PDB Compounds: (B:) L-asparaginase 1

SCOPe Domain Sequences for d2himb1:

Sequence, based on SEQRES records: (download)

>d2himb1 c.88.1.1 (B:1-337) automated matches {Escherichia coli [TaxId: 562]}
mqkksiyvaytggtigmqrseqgyipvsghlqrqlalmpefhrpempdftiheytplmds
sdmtpedwqhiaedikahyddydgfvilhgtdtmaytasalsfmlenlgkpvivtgsqip
laelrsdgqinllnalyvaanypinevtlffnnrlyrgnrtakahadgfdafaspnlppl
leagihirrlntppaphgegelivhpitpqpigvvtiypgisadvvrnflrqpvkalilr
sygvgnapqnkaflqelqeasdrgivvvnltqcmsgkvnmggyatgnalahagviggadm
tveatltklhyllsqeldtetirkamsqnlrgeltpd

Sequence, based on observed residues (ATOM records): (download)

>d2himb1 c.88.1.1 (B:1-337) automated matches {Escherichia coli [TaxId: 562]}
mqkksiyvaytggtigmqrsghlqrqlalmpefhrpempdftiheytplmdssdmtpedw
qhiaedikahyddydgfvilhgtdtmaytasalsfmlenlgkpvivtgsqiplaelrsdg
qinllnalyvaanypinevtlffnnrlyrgnrtakahadgfdafaspnlpplleagihir
rlntppaphgegelivhpitpqpigvvtiypgisadvvrnflrqpvkalilrsygvgnap
qnkaflqelqeasdrgivvvnltqcmsgkvnmnalahagviggadmtveatltklhylls
qeldtetirkamsqnlrgeltpd

SCOPe Domain Coordinates for d2himb1:

Click to download the PDB-style file with coordinates for d2himb1.
(The format of our PDB-style files is described here.)

Timeline for d2himb1: