| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
| Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
| Protein automated matches [226907] (28 species) not a true protein |
| Species Sulfolobus solfataricus [TaxId:2287] [225132] (4 PDB entries) |
| Domain d2hiiz2: 2hii Z:127-243 [204559] automated match to d1ud9a2 |
PDB Entry: 2hii (more details), 2.79 Å
SCOPe Domain Sequences for d2hiiz2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hiiz2 d.131.1.0 (Z:127-243) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
qfdisatissdgfksaisevstvtdnvvveghedrilikaegesevevefskdtgglqdl
efskesknsysaeylddvlsltklsdyvkisfgnqkplqlffnmegggkvtyllapk
Timeline for d2hiiz2: