SCOPe 2.07: Domain d2hiiz1: 2hii Z:1-126

Lineage for d2hiiz1 (2hii Z:1-126)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [225132] (4 PDB entries)

8. Domain d2hiiz1: 2hii Z:1-126 [204558]
   automated match to d1ud9a1

Details for d2hiiz1

PDB Entry: 2hii, 2.79 Å

PDB Description: heterotrimeric pcna sliding clamp

PDB Compounds: (Z:) pcna3 (sso0405)

SCOPe Domain Sequences for d2hiiz1:

Sequence; same for both SEQRES and ATOM records:

>d2hiiz1 d.131.1.0 (Z:1-126) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mkvvyddvrvlkdiiqalarlvdeavlkfkqdsvelvaldrahislisvnlpremfkeyd
vndefkfgfntqylmkilkvakrkeaieiasespdsviiniigstnrefnvrnlevseqe
ipeinl

Timeline for d2hiiz1:

• d2hiiz1 first appeared in SCOPe 2.03
  
• d2hiiz1 appears in SCOPe 2.06
  
• d2hiiz1 appears in the current release, SCOPe 2.08