Lineage for d2hiiy1 (2hii Y:2-127)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977231Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2977232Protein automated matches [226907] (28 species)
    not a true protein
  7. 2977472Species Sulfolobus solfataricus [TaxId:2287] [225132] (4 PDB entries)
  8. 2977483Domain d2hiiy1: 2hii Y:2-127 [204556]
    automated match to d1ud9a1

Details for d2hiiy1

PDB Entry: 2hii (more details), 2.79 Å

PDB Description: heterotrimeric pcna sliding clamp
PDB Compounds: (Y:) pcna2 (sso1047)

SCOPe Domain Sequences for d2hiiy1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hiiy1 d.131.1.0 (Y:2-127) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mkakvidavsfsyilrtvgdflseanfivtkegirvsgidpsrvvfldiflpssyfegfe
vsqekeiigfkledvndilkrvlkddtlilssneskltltfdgeftrsfelpliqvestq
ppsvnl

SCOPe Domain Coordinates for d2hiiy1:

Click to download the PDB-style file with coordinates for d2hiiy1.
(The format of our PDB-style files is described here.)

Timeline for d2hiiy1: