SCOPe 2.04: Domain d2hiib2: 2hii B:128-244

Lineage for d2hiib2 (2hii B:128-244)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (12 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [225132] (4 PDB entries)

8. Domain d2hiib2: 2hii B:128-244 [204553]
   automated match to d1ud9a2

Details for d2hiib2

PDB Entry: 2hii, 2.79 Å

PDB Description: heterotrimeric pcna sliding clamp

PDB Compounds: (B:) pcna2 (sso1047)

SCOPe Domain Sequences for d2hiib2:

Sequence; same for both SEQRES and ATOM records:

>d2hiib2 d.131.1.0 (B:128-244) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
efpfkaqlltitfadiidelsdlgevlnihskenklyfevigdlstakvelstdngtlle
asgadvsssygmeyvanttkmrrasdsmelyfgsqiplklrfklpqegygdfyiapr

Timeline for d2hiib2:

• d2hiib2 first appeared in SCOPe 2.03
  
• d2hiib2 appears in SCOPe 2.05
  
• d2hiib2 appears in the current release, SCOPe 2.08