SCOPe 2.07: Domain d2hend1: 2hen D:622-901

Lineage for d2hend1 (2hen D:622-901)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187169] (41 PDB entries)

8. Domain d2hend1: 2hen D:622-901 [204551]
   Other proteins in same PDB: d2hena2, d2henb2, d2henc2, d2hend2
   automated match to d1mqba_
   complexed with adp, mg

Details for d2hend1

PDB Entry: 2hen, 2.6 Å

PDB Description: crystal structure of the ephb2 receptor kinase domain in complex with adp

PDB Compounds: (D:) ephrin type-b receptor 2

SCOPe Domain Sequences for d2hend1:

Sequence, based on SEQRES records:

>d2hend1 d.144.1.7 (D:622-901) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
keidiscvkieqvigagefgevcsghlklpgkreifvaiktlksgytekqrrdflseasi
mgqfdhpnvihlegvvtkstpvmiitefmengsldsflrqndgqftviqlvgmlrgiaag
mkyladmnyvhralaarnilvnsnlvckvsdfglsrfleddtsdptytsalggkipirwt
apeaiqyrkftsasdvwsygivmwevmsygerpywdmtnqdvinaieqdyrlpppmdcps
alhqlmldcwqkdrnhrpkfgqivntldkmirnpnslkam

Sequence, based on observed residues (ATOM records):

>d2hend1 d.144.1.7 (D:622-901) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
keidiscvkieqvigagefgevcsghlklpgkreifvaiktlksgytekqrrdflseasi
mgqfdhpnvihlegvvtkstpvmiitefmengsldsflrqndgqftviqlvgmlrgiaag
mkyladmnyvhralaarnilvnsnlvckvsdfgpirwtapeaiqyrkftsasdvwsygiv
mwevmsygerpywdmtnqdvinaieqdyrlpppmdcpsalhqlmldcwqkdrnhrpkfgq
ivntldkmirnpnslkam

Timeline for d2hend1:

• d2hend1 first appeared in SCOPe 2.03, called d2hend_
  
• d2hend1 appears in SCOPe 2.06
  
• d2hend1 appears in the current release, SCOPe 2.08