SCOP 1.63: Domain d1f4yh1: 1f4y H:1-117

Lineage for d1f4yh1 (1f4y H:1-117)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Anti-carbohydrate Fab S-20-4 (mouse), lambda L chain [48898] (3 PDB entries)

8. Domain d1f4yh1: 1f4y H:1-117 [20455]
   Other proteins in same PDB: d1f4yh2, d1f4yl2
   complexed with mgu

Details for d1f4yh1

PDB Entry: 1f4y, 2.8 Å

PDB Description: crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen

SCOP Domain Sequences for d1f4yh1:

Sequence; same for both SEQRES and ATOM records:

>d1f4yh1 b.1.1.1 (H:1-117) Immunoglobulin (variable domains of L and H chains) {Anti-carbohydrate Fab S-20-4 (mouse), lambda L chain}
evqleesggglvtpggslrlscaasgyvfstydmswvrqtpekrlewvafissgggrtsy
pdtvkgrftisrddakntlylqmsslqsedtamyyctrhfyavldywgrgttltvss

Timeline for d1f4yh1:

• d1f4yh1 first appeared (with stable ids) in SCOP 1.55
  
• d1f4yh1 appears in SCOP 1.61
  
• d1f4yh1 appears in SCOP 1.65
  
• d1f4yh1 appears in the current release, SCOPe 2.08