Lineage for d2hdbb2 (2hdb B:168-383)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916987Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)
  6. 2916988Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS, C-terminal domain [419029] (2 species)
    most similar to FabH
  7. 2916989Species Enterococcus faecalis [TaxId:1351] [419511] (4 PDB entries)
  8. 2917001Domain d2hdbb2: 2hdb B:168-383 [204543]
    Other proteins in same PDB: d2hdba1, d2hdbb1
    automated match to d1xpma2
    complexed with mes, so4; mutant

    has additional subdomain(s) that are not in the common domain

Details for d2hdbb2

PDB Entry: 2hdb (more details), 2.2 Å

PDB Description: hmg-coa synthase from enterococcus faecalis. mutation alanine 110 to glycine
PDB Compounds: (B:) HMG-CoA synthase

SCOPe Domain Sequences for d2hdbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hdbb2 c.95.1.2 (B:168-383) 3-hydroxy-3-methylglutaryl CoA synthase MvaS, C-terminal domain {Enterococcus faecalis [TaxId: 1351]}
ilalkednvmltqdiydfwrptghpypmvdgplsnetyiqsfaqvwdehkkrtgldfady
dalafhipytkmgkkallakisdqteaeqerilaryeesiiysrrvgnlytgslylglis
llenattltagnqiglfsygsgavaefftgelvagyqnhlqkethlalldnrtelsiaey
eamfaetldtdidqtledelkysisainntvrsyrn

SCOPe Domain Coordinates for d2hdbb2:

Click to download the PDB-style file with coordinates for d2hdbb2.
(The format of our PDB-style files is described here.)

Timeline for d2hdbb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hdbb1