| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins) |
| Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS, C-terminal domain [419029] (2 species) most similar to FabH |
| Species Enterococcus faecalis [TaxId:1351] [419511] (4 PDB entries) |
| Domain d2hdba2: 2hdb A:168-383 [204541] Other proteins in same PDB: d2hdba1, d2hdbb1 automated match to d1xpma2 complexed with mes, so4; mutant has additional subdomain(s) that are not in the common domain |
PDB Entry: 2hdb (more details), 2.2 Å
SCOPe Domain Sequences for d2hdba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hdba2 c.95.1.2 (A:168-383) 3-hydroxy-3-methylglutaryl CoA synthase MvaS, C-terminal domain {Enterococcus faecalis [TaxId: 1351]}
ilalkednvmltqdiydfwrptghpypmvdgplsnetyiqsfaqvwdehkkrtgldfady
dalafhipytkmgkkallakisdqteaeqerilaryeesiiysrrvgnlytgslylglis
llenattltagnqiglfsygsgavaefftgelvagyqnhlqkethlalldnrtelsiaey
eamfaetldtdidqtledelkysisainntvrsyrn
Timeline for d2hdba2: