SCOPe 2.08: Domain d2hczx2: 2hcz X:146-245

Lineage for d2hczx2 (2hcz X:146-245)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.3: PHL pollen allergen [49590] (2 families)

5. Family b.7.3.0: automated matches [191612] (1 protein)
   not a true family

6. Protein automated matches [191118] (2 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [225119] (1 PDB entry)

8. Domain d2hczx2: 2hcz X:146-245 [204539]
   Other proteins in same PDB: d2hczx1
   automated match to d1n10a1

Details for d2hczx2

PDB Entry: 2hcz, 2.75 Å

PDB Description: crystal structure of expb1 (zea m 1), a beta-expansin and group-1 pollen allergen from maize

PDB Compounds: (X:) Beta-expansin 1a

SCOPe Domain Sequences for d2hczx2:

Sequence; same for both SEQRES and ATOM records:

>d2hczx2 b.7.3.0 (X:146-245) automated matches {Maize (Zea mays) [TaxId: 4577]}
qkivfhiekgcnpnylavlvkyvaddgdivlmeiqdklsaewkpmklswgaiwrmdtaka
lkgpfsirltsesgkkviakdvipanwrpdavytsnvqfy

Timeline for d2hczx2:

• d2hczx2 first appeared in SCOPe 2.03
  
• d2hczx2 appears in SCOPe 2.07