SCOPe 2.08: Domain d2hcra2: 2hcr A:161-313

Lineage for d2hcra2 (2hcr A:161-313)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225156] (13 PDB entries)

8. Domain d2hcra2: 2hcr A:161-313 [204535]
   automated match to d2c4ka2
   complexed with amp, cd, so4

Details for d2hcra2

PDB Entry: 2hcr, 2.2 Å

PDB Description: crystal structure of human phosphoribosyl pyrophosphate synthetase 1 in complex with AMP(ATP), cadmium and sulfate ion

PDB Compounds: (A:) Ribose-phosphate pyrophosphokinase I

SCOPe Domain Sequences for d2hcra2:

Sequence, based on SEQRES records:

>d2hcra2 c.61.1.0 (A:161-313) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewrnctivspdaggakrvtsiadrlnvdfalihkerkkanevdrmvlvgdvkdrvailvd
dmadtcgtichaadkllsagatrvyailthgifsgpaisrinnacfeavvvtntipqedk
mkhcskiqvidismilaeairrthngesvsylf

Sequence, based on observed residues (ATOM records):

>d2hcra2 c.61.1.0 (A:161-313) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewrnctivspdaggakrvtsiadrlnvdfalihkerdrmvlvgdvkdrvailvddmadtc
gtichaadkllsagatrvyailthgifsgpaisrinnacfeavvvtntipqedkmkhcsk
iqvidismilaeairrthngesvsylf

Timeline for d2hcra2:

• d2hcra2 first appeared in SCOPe 2.03
  
• d2hcra2 appears in SCOPe 2.07