![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
![]() | Protein automated matches [190891] (38 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225156] (13 PDB entries) |
![]() | Domain d2hcra2: 2hcr A:161-313 [204535] automated match to d2c4ka2 complexed with amp, cd, so4 |
PDB Entry: 2hcr (more details), 2.2 Å
SCOPe Domain Sequences for d2hcra2:
Sequence, based on SEQRES records: (download)
>d2hcra2 c.61.1.0 (A:161-313) automated matches {Human (Homo sapiens) [TaxId: 9606]} ewrnctivspdaggakrvtsiadrlnvdfalihkerkkanevdrmvlvgdvkdrvailvd dmadtcgtichaadkllsagatrvyailthgifsgpaisrinnacfeavvvtntipqedk mkhcskiqvidismilaeairrthngesvsylf
>d2hcra2 c.61.1.0 (A:161-313) automated matches {Human (Homo sapiens) [TaxId: 9606]} ewrnctivspdaggakrvtsiadrlnvdfalihkerdrmvlvgdvkdrvailvddmadtc gtichaadkllsagatrvyailthgifsgpaisrinnacfeavvvtntipqedkmkhcsk iqvidismilaeairrthngesvsylf
Timeline for d2hcra2: