SCOPe 2.03: Domain d2hbwa2: 2hbw A:87-234

Lineage for d2hbwa2 (2hbw A:87-234)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.16: NlpC/P60 [142873] (2 proteins)
   Pfam PF00877

6. Protein automated matches [226896] (1 species)
   not a true protein

7. Species Anabaena variabilis [TaxId:240292] [225111] (1 PDB entry)

8. Domain d2hbwa2: 2hbw A:87-234 [204533]
   Other proteins in same PDB: d2hbwa1
   automated match to d2evra2
   complexed with act, unl

Details for d2hbwa2

PDB Entry: 2hbw, 1.05 Å

PDB Description: crystal structure of a putative endopeptidase (ava_3396) from anabaena variabilis atcc 29413 at 1.05 a resolution

PDB Compounds: (A:) NLP/P60 protein

SCOPe Domain Sequences for d2hbwa2:

Sequence; same for both SEQRES and ATOM records:

>d2hbwa2 d.3.1.16 (A:87-234) automated matches {Anabaena variabilis [TaxId: 240292]}
sfseseikkllpgaiaftqkamqqsnyylwggtvgpnydcsglmqaafvsvgiwlprday
qqeaftqaitidelapgdlvffgtpvkathvglylgdgcyihssgkaqgrdgigidilse
qgdvvsrsyyqqlrgagrvvksykpqrh

Timeline for d2hbwa2:

• d2hbwa2 is new in SCOPe 2.03-stable
  
• d2hbwa2 appears in SCOPe 2.04
  
• d2hbwa2 appears in the current release, SCOPe 2.08