SCOPe 2.03: Domain d2hb5a_: 2hb5 A:

Lineage for d2hb5a_ (2hb5 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (20 species)
   not a true protein

7. Species Moloney murine leukemia virus [TaxId:11801] [225127] (1 PDB entry)

8. Domain d2hb5a_: 2hb5 A: [204531]
   automated match to d4e89a_
   complexed with mg, so4

Details for d2hb5a_

PDB Entry: 2hb5, 1.59 Å

PDB Description: crystal structure of the moloney murine leukemia virus rnase h domain

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d2hb5a_:

Sequence, based on SEQRES records:

>d2hb5a_ c.55.3.0 (A:) automated matches {Moloney murine leukemia virus [TaxId: 11801]}
hgtrpdltdqplpdadhtwytdgssllqegqrkagaavtteteviwakalpagtsaqrae
lialtqalkmaegkklnvytdsryafatahltsegkeiknkdeilallkalflpkrlsii
hcpghqkghsaeargnrmadqaarkaaitetpdts

Sequence, based on observed residues (ATOM records):

>d2hb5a_ c.55.3.0 (A:) automated matches {Moloney murine leukemia virus [TaxId: 11801]}
hgtrpdltdqplpdadhtwytdgssllqegqrkagaavtteteviwakalpagtsaqrae
lialtqalkmaegkklnvytdsryafatahltsegkeiknkdeilallkalflpkrlsii
hcghsaeargnrmadqaarkaaitetpdts

Timeline for d2hb5a_:

• d2hb5a_ is new in SCOPe 2.03-stable
  
• d2hb5a_ appears in SCOPe 2.04
  
• d2hb5a_ appears in the current release, SCOPe 2.08