Lineage for d2hb5a_ (2hb5 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124881Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2124882Protein automated matches [190396] (34 species)
    not a true protein
  7. 2125065Species Moloney murine leukemia virus [TaxId:11801] [225127] (1 PDB entry)
  8. 2125066Domain d2hb5a_: 2hb5 A: [204531]
    automated match to d4e89a_
    complexed with mg, so4

Details for d2hb5a_

PDB Entry: 2hb5 (more details), 1.59 Å

PDB Description: crystal structure of the moloney murine leukemia virus rnase h domain
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d2hb5a_:

Sequence, based on SEQRES records: (download)

>d2hb5a_ c.55.3.0 (A:) automated matches {Moloney murine leukemia virus [TaxId: 11801]}
hgtrpdltdqplpdadhtwytdgssllqegqrkagaavtteteviwakalpagtsaqrae
lialtqalkmaegkklnvytdsryafatahltsegkeiknkdeilallkalflpkrlsii
hcpghqkghsaeargnrmadqaarkaaitetpdts

Sequence, based on observed residues (ATOM records): (download)

>d2hb5a_ c.55.3.0 (A:) automated matches {Moloney murine leukemia virus [TaxId: 11801]}
hgtrpdltdqplpdadhtwytdgssllqegqrkagaavtteteviwakalpagtsaqrae
lialtqalkmaegkklnvytdsryafatahltsegkeiknkdeilallkalflpkrlsii
hcghsaeargnrmadqaarkaaitetpdts

SCOPe Domain Coordinates for d2hb5a_:

Click to download the PDB-style file with coordinates for d2hb5a_.
(The format of our PDB-style files is described here.)

Timeline for d2hb5a_: