SCOPe 2.03: Domain d2h9la_: 2h9l A:

Lineage for d2h9la_ (2h9l A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (3 families)
   also contains 8-bladed propellers

5. Family b.69.4.0: automated matches [191412] (1 protein)
   not a true family

6. Protein automated matches [190568] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187559] (33 PDB entries)

8. Domain d2h9la_: 2h9l A: [204530]
   automated match to d2cnxa_
   complexed with so4

Details for d2h9la_

PDB Entry: 2h9l, 1.75 Å

PDB Description: WDR5delta23

PDB Compounds: (A:) wd-repeat protein 5

SCOPe Domain Sequences for d2h9la_:

Sequence; same for both SEQRES and ATOM records:

>d2h9la_ b.69.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgrenlyfqgtqskptpvkpnyalkftlaghtkavssvkfspngewlasssadklikiwg
aydgkfektisghklgisdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvf
ccnfnpqsnlivsgsfdesvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydg
lcriwdtasgqclktlidddnppvsfvkfspngkyilaatldntlklwdyskgkclktyt
ghknekycifanfsvtggkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpte
niiasaalendktiklwksdc

Timeline for d2h9la_:

• d2h9la_ is new in SCOPe 2.03-stable
  
• d2h9la_ appears in SCOPe 2.04
  
• d2h9la_ appears in the current release, SCOPe 2.08, called d2h9la1