Lineage for d2h9la1 (2h9l A:24-334)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065971Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2066122Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2066123Protein automated matches [190568] (6 species)
    not a true protein
  7. 2066160Species Human (Homo sapiens) [TaxId:9606] [187559] (46 PDB entries)
  8. 2066175Domain d2h9la1: 2h9l A:24-334 [204530]
    Other proteins in same PDB: d2h9la2
    automated match to d2cnxa_
    complexed with so4

Details for d2h9la1

PDB Entry: 2h9l (more details), 1.75 Å

PDB Description: WDR5delta23
PDB Compounds: (A:) wd-repeat protein 5

SCOPe Domain Sequences for d2h9la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h9la1 b.69.4.0 (A:24-334) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqskptpvkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfekti
sghklgisdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnl
ivsgsfdesvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasg
qclktlidddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycif
anfsvtggkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalen
dktiklwksdc

SCOPe Domain Coordinates for d2h9la1:

Click to download the PDB-style file with coordinates for d2h9la1.
(The format of our PDB-style files is described here.)

Timeline for d2h9la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h9la2