Lineage for d1f4wh1 (1f4w H:1-117)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740087Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (62 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 2740127Domain d1f4wh1: 1f4w H:1-117 [20453]
    Other proteins in same PDB: d1f4wh2, d1f4wl1, d1f4wl2
    part of anti-carbohydrate Fab S-20-4

Details for d1f4wh1

PDB Entry: 1f4w (more details), 2.3 Å

PDB Description: crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen
PDB Compounds: (H:) antibody s-20-4, fab fragment, heavy chain

SCOPe Domain Sequences for d1f4wh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4wh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evqleesggglvtpggslrlscaasgyvfstydmswvrqtpekrlewvafissgggrtsy
pdtvkgrftisrddakntlylqmsslqsedtamyyctrhfyavldywgrgttltvss

SCOPe Domain Coordinates for d1f4wh1:

Click to download the PDB-style file with coordinates for d1f4wh1.
(The format of our PDB-style files is described here.)

Timeline for d1f4wh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f4wh2