![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Dictyostelium discoideum [TaxId:352472] [225117] (1 PDB entry) |
![]() | Domain d2h84b2: 2h84 B:2999-3147 [204529] automated match to d1bi5a2 complexed with p6g |
PDB Entry: 2h84 (more details), 2.9 Å
SCOPe Domain Sequences for d2h84b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h84b2 c.95.1.0 (B:2999-3147) automated matches {Dictyostelium discoideum [TaxId: 352472]} lyevmcsinrsfpntenamvwdlekegwnlgldasipivigsgieafvdtlldkaklqts taisakdceflihtggksilmnienslgidpkqtkntwdvyhaygnmssasvifvmdhar kskslptysislafgpglafegcflknvv
Timeline for d2h84b2: