Lineage for d2h84b2 (2h84 B:2999-3147)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917611Species Dictyostelium discoideum [TaxId:352472] [225117] (1 PDB entry)
  8. 2917615Domain d2h84b2: 2h84 B:2999-3147 [204529]
    automated match to d1bi5a2
    complexed with p6g

Details for d2h84b2

PDB Entry: 2h84 (more details), 2.9 Å

PDB Description: crystal structure of the c-terminal type iii polyketide synthase (pks iii) domain of 'steely1' (a type i/iii pks hybrid from dictyostelium)
PDB Compounds: (B:) Steely1

SCOPe Domain Sequences for d2h84b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h84b2 c.95.1.0 (B:2999-3147) automated matches {Dictyostelium discoideum [TaxId: 352472]}
lyevmcsinrsfpntenamvwdlekegwnlgldasipivigsgieafvdtlldkaklqts
taisakdceflihtggksilmnienslgidpkqtkntwdvyhaygnmssasvifvmdhar
kskslptysislafgpglafegcflknvv

SCOPe Domain Coordinates for d2h84b2:

Click to download the PDB-style file with coordinates for d2h84b2.
(The format of our PDB-style files is described here.)

Timeline for d2h84b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h84b1