| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Plasmodium vivax [TaxId:5855] [225085] (1 PDB entry) |
| Domain d2h66h_: 2h66 H: [204522] Other proteins in same PDB: d2h66c2, d2h66i2 automated match to d1uula_ |
PDB Entry: 2h66 (more details), 2.5 Å
SCOPe Domain Sequences for d2h66h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h66h_ c.47.1.0 (H:) automated matches {Plasmodium vivax [TaxId: 5855]}
ptyvgkeapffkaeavfgdnsfgevnltqfigkkyvllyfypldftfvcpseiialdkal
dafhernvellgcsvdskythlawkktplakggignikhtllsditksiskdynvlfdds
vslrafvlidmngivqhllvnnlaigrsvdeilriidaiqhhekygd
Timeline for d2h66h_: