Lineage for d2h66f_ (2h66 F:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1855332Species Plasmodium vivax [TaxId:5855] [225085] (1 PDB entry)
  8. 1855338Domain d2h66f_: 2h66 F: [204520]
    automated match to d1uula_

Details for d2h66f_

PDB Entry: 2h66 (more details), 2.5 Å

PDB Description: The Crystal Structure of Plasmodium Vivax 2-Cys peroxiredoxin
PDB Compounds: (F:) pv-pf14_0368

SCOPe Domain Sequences for d2h66f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h66f_ c.47.1.0 (F:) automated matches {Plasmodium vivax [TaxId: 5855]}
tyvgkeapffkaeavfgdnsfgevnltqfigkkyvllyfypldftfvcpseiialdkald
afhernvellgcsvdskythlawkktplakggignikhtllsditksiskdynvlfddsv
slrafvlidmngivqhllvnnlaigrsvdeilriidaiqhhekygdvc

SCOPe Domain Coordinates for d2h66f_:

Click to download the PDB-style file with coordinates for d2h66f_.
(The format of our PDB-style files is described here.)

Timeline for d2h66f_: