Lineage for d2h5yc_ (2h5y C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2523754Species Xanthomonas axonopodis [TaxId:190486] [225275] (3 PDB entries)
  8. 2523757Domain d2h5yc_: 2h5y C: [204514]
    automated match to d1amfa_
    complexed with moo, so4

Details for d2h5yc_

PDB Entry: 2h5y (more details), 1.7 Å

PDB Description: crystallographic structure of the molybdate-binding protein of xanthomonas citri at 1.7 ang resolution bound to molybdate
PDB Compounds: (C:) Molybdate-binding periplasmic protein

SCOPe Domain Sequences for d2h5yc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h5yc_ c.94.1.0 (C:) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
tapvtvfaaaslkesmdeaatayekatgtpvrvsyaassalarqieqgapadvflsadle
wmdylqqhglvlpaqrhnllgntlvlvapassklrvdprapgaiakalgengrlavgqta
svpagkyaaaalrklgqwdsvsnrlaesesvraalmlvsrgeaplgivygsdaradakvr
vvatfpddshdaivypvaalknsnnpataafvswlgskpakaifarrgfslk

SCOPe Domain Coordinates for d2h5yc_:

Click to download the PDB-style file with coordinates for d2h5yc_.
(The format of our PDB-style files is described here.)

Timeline for d2h5yc_: