![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
![]() | Protein automated matches [190039] (161 species) not a true protein |
![]() | Species Xanthomonas axonopodis [TaxId:190486] [225275] (3 PDB entries) |
![]() | Domain d2h5yc_: 2h5y C: [204514] automated match to d1amfa_ complexed with moo, so4 |
PDB Entry: 2h5y (more details), 1.7 Å
SCOPe Domain Sequences for d2h5yc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h5yc_ c.94.1.0 (C:) automated matches {Xanthomonas axonopodis [TaxId: 190486]} tapvtvfaaaslkesmdeaatayekatgtpvrvsyaassalarqieqgapadvflsadle wmdylqqhglvlpaqrhnllgntlvlvapassklrvdprapgaiakalgengrlavgqta svpagkyaaaalrklgqwdsvsnrlaesesvraalmlvsrgeaplgivygsdaradakvr vvatfpddshdaivypvaalknsnnpataafvswlgskpakaifarrgfslk
Timeline for d2h5yc_: