SCOPe 2.05: Domain d2h5yb_: 2h5y B:

Lineage for d2h5yb_ (2h5y B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (120 species)
   not a true protein

7. Species Xanthomonas axonopodis [TaxId:190486] [225275] (2 PDB entries)

8. Domain d2h5yb_: 2h5y B: [204513]
   automated match to d1amfa_
   complexed with moo, so4

Details for d2h5yb_

PDB Entry: 2h5y, 1.7 Å

PDB Description: crystallographic structure of the molybdate-binding protein of xanthomonas citri at 1.7 ang resolution bound to molybdate

PDB Compounds: (B:) Molybdate-binding periplasmic protein

SCOPe Domain Sequences for d2h5yb_:

Sequence; same for both SEQRES and ATOM records:

>d2h5yb_ c.94.1.0 (B:) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
qtapvtvfaaaslkesmdeaatayekatgtpvrvsyaassalarqieqgapadvflsadl
ewmdylqqhglvlpaqrhnllgntlvlvapassklrvdprapgaiakalgengrlavgqt
asvpagkyaaaalrklgqwdsvsnrlaesesvraalmlvsrgeaplgivygsdaradakv
rvvatfpddshdaivypvaalknsnnpataafvswlgskpakaifarrgfslk

Timeline for d2h5yb_:

• d2h5yb_ first appeared in SCOPe 2.03
  
• d2h5yb_ appears in SCOPe 2.04
  
• d2h5yb_ appears in SCOPe 2.06
  
• d2h5yb_ appears in the current release, SCOPe 2.08