SCOPe 2.07: Domain d2h3gx1: 2h3g X:1-122

Lineage for d2h3gx1 (2h3g X:1-122)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (63 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:198094] [225238] (1 PDB entry)

8. Domain d2h3gx1: 2h3g X:1-122 [204509]
   automated match to d3bexa1
   complexed with edo

Details for d2h3gx1

PDB Entry: 2h3g, 2 Å

PDB Description: structure of the type iii pantothenate kinase (coax) from bacillus anthracis

PDB Compounds: (X:) biosynthetic protein

SCOPe Domain Sequences for d2h3gx1:

Sequence; same for both SEQRES and ATOM records:

>d2h3gx1 c.55.1.0 (X:1-122) automated matches {Bacillus anthracis [TaxId: 198094]}
mifvldvgntnavlgvfeegelrqhwrmetdrhktedeygmlvkqlleheglsfedvkgi
ivssvvppimfalermcekyfkikplvvgpgiktglnikyenprevgadrivnavagihl
yg

Timeline for d2h3gx1:

• d2h3gx1 first appeared in SCOPe 2.03
  
• d2h3gx1 appears in SCOPe 2.06
  
• d2h3gx1 appears in the current release, SCOPe 2.08