![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.67.3: Apyrase [101887] (1 family) ![]() distorted propeller with an alpha helix inserted between the second and third blades automatically mapped to Pfam PF06079 |
![]() | Family b.67.3.1: Apyrase [101888] (1 protein) Pfam PF06079 |
![]() | Protein Soluble calcium-activated nucleotidase SCAN-1 [101889] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101890] (4 PDB entries) |
![]() | Domain d2h2ua_: 2h2u A: [204507] automated match to d1s1da_ complexed with ca; mutant |
PDB Entry: 2h2u (more details), 2.4 Å
SCOPe Domain Sequences for d2h2ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h2ua_ b.67.3.1 (A:) Soluble calcium-activated nucleotidase SCAN-1 {Human (Homo sapiens) [TaxId: 9606]} yndtyplsppqrtpagiryriaviadldtesraqeentwfsylkkgyltlsdsgdkvave wdkdhgvleshlaykgrgmelsdlivfngklysvddrtgvvyqiegskavpwvilsdgdg tvekgfkaewlavkderlyvgglgkewttttgdvvnenpewvkvvgykgsvdhenwvsny nalraaagiqppgylihesacwsdtlqrwfflprrasqerysekdderkganlllsaspd fgdiavshvgavvpthgfssfkfipntddqiivalkseedsgrvasyimaftldgrfllp etkigsvkyegiefi
Timeline for d2h2ua_: