Lineage for d2h2ua_ (2h2u A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416839Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2417076Superfamily b.67.3: Apyrase [101887] (1 family) (S)
    distorted propeller with an alpha helix inserted between the second and third blades
    automatically mapped to Pfam PF06079
  5. 2417077Family b.67.3.1: Apyrase [101888] (1 protein)
    Pfam PF06079
  6. 2417078Protein Soluble calcium-activated nucleotidase SCAN-1 [101889] (1 species)
  7. 2417079Species Human (Homo sapiens) [TaxId:9606] [101890] (4 PDB entries)
  8. 2417086Domain d2h2ua_: 2h2u A: [204507]
    automated match to d1s1da_
    complexed with ca; mutant

Details for d2h2ua_

PDB Entry: 2h2u (more details), 2.4 Å

PDB Description: crystal structure of the e130y mutant of human soluble calcium- activated nucleotidase (scan) with calcium ion
PDB Compounds: (A:) Soluble calcium-activated nucleotidase 1

SCOPe Domain Sequences for d2h2ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h2ua_ b.67.3.1 (A:) Soluble calcium-activated nucleotidase SCAN-1 {Human (Homo sapiens) [TaxId: 9606]}
yndtyplsppqrtpagiryriaviadldtesraqeentwfsylkkgyltlsdsgdkvave
wdkdhgvleshlaykgrgmelsdlivfngklysvddrtgvvyqiegskavpwvilsdgdg
tvekgfkaewlavkderlyvgglgkewttttgdvvnenpewvkvvgykgsvdhenwvsny
nalraaagiqppgylihesacwsdtlqrwfflprrasqerysekdderkganlllsaspd
fgdiavshvgavvpthgfssfkfipntddqiivalkseedsgrvasyimaftldgrfllp
etkigsvkyegiefi

SCOPe Domain Coordinates for d2h2ua_:

Click to download the PDB-style file with coordinates for d2h2ua_.
(The format of our PDB-style files is described here.)

Timeline for d2h2ua_: