Lineage for d2h2ka_ (2h2k A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268646Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1268647Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1269770Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 1269771Protein automated matches [190513] (10 species)
    not a true protein
  7. 1269774Species Human (Homo sapiens) [TaxId:9606] [189519] (10 PDB entries)
  8. 1269783Domain d2h2ka_: 2h2k A: [204505]
    automated match to d1irjb_
    complexed with ca

Details for d2h2ka_

PDB Entry: 2h2k (more details), 2 Å

PDB Description: Crystal Structure Analysis of Human S100A13
PDB Compounds: (A:) Protein S100-A13

SCOPe Domain Sequences for d2h2ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h2ka_ a.39.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slmaaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgslde
kmksldvnqdselkfneywrligelakeirkkk

SCOPe Domain Coordinates for d2h2ka_:

Click to download the PDB-style file with coordinates for d2h2ka_.
(The format of our PDB-style files is described here.)

Timeline for d2h2ka_: