SCOPe 2.08: Domain d2h2ka1: 2h2k A:1-91

Lineage for d2h2ka1 (2h2k A:1-91)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (36 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189519] (58 PDB entries)

8. Domain d2h2ka1: 2h2k A:1-91 [204505]
   Other proteins in same PDB: d2h2ka2
   automated match to d1irjb_
   complexed with ca

Details for d2h2ka1

PDB Entry: 2h2k, 2 Å

PDB Description: Crystal Structure Analysis of Human S100A13

PDB Compounds: (A:) Protein S100-A13

SCOPe Domain Sequences for d2h2ka1:

Sequence; same for both SEQRES and ATOM records:

>d2h2ka1 a.39.1.0 (A:1-91) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
ksldvnqdselkfneywrligelakeirkkk

Timeline for d2h2ka1:

• d2h2ka1 first appeared in SCOPe 2.03, called d2h2ka_
  
• d2h2ka1 appears in SCOPe 2.07