Lineage for d2h1rb_ (2h1r B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (64 species)
    not a true protein
  7. 2130786Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [225077] (1 PDB entry)
  8. 2130788Domain d2h1rb_: 2h1r B: [204504]
    automated match to d1zq9a1

Details for d2h1rb_

PDB Entry: 2h1r (more details), 1.89 Å

PDB Description: Crystal structure of a dimethyladenosine transferase from Plasmodium falciparum
PDB Compounds: (B:) Dimethyladenosine transferase, putative

SCOPe Domain Sequences for d2h1rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h1rb_ c.66.1.0 (B:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
hllknpgildkiiyaakikssdivleigcgtgnltvkllplakkvitididsrmisevkk
rclyegynnlevyegdaiktvfpkfdvctanipykissplifklishrplfkcavlmfqk
efaermlanvgdsnysrltinvklfckvtkvcnvnrssfnpppkvdsvivklipkessfl
tnfdewdnllricfsrkrktlhaifkrnavlnmlehnyknwctlnkqvpvnfpfkkycld
vlehldmcekrsinldendflklllefnkkgihff

SCOPe Domain Coordinates for d2h1rb_:

Click to download the PDB-style file with coordinates for d2h1rb_.
(The format of our PDB-style files is described here.)

Timeline for d2h1rb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2h1ra_