SCOPe 2.06: Domain d2h18a1: 2h18 A:9-181

Lineage for d2h18a1 (2h18 A:9-181)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries)

8. Domain d2h18a1: 2h18 A:9-181 [204502]
   Other proteins in same PDB: d2h18a2
   automated match to d2gf9a_
   complexed with gdp, unx

Details for d2h18a1

PDB Entry: 2h18, 1.9 Å

PDB Description: structure of human adp-ribosylation factor-like 10b (arl10b)

PDB Compounds: (A:) ADP-ribosylation factor-like protein 8A

SCOPe Domain Sequences for d2h18a1:

Sequence, based on SEQRES records:

>d2h18a1 c.37.1.0 (A:9-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldwfkalfwkeemeltlvglqysgkttfvnviasgqfnedmiptvgfnmrkitkgnvtik
lwdiggqprfrsmwerycrgvsaivymvdaadqekieasknelhnlldkpqlqgipvlvl
gnkrdlpgaldekeliekmnlsaiqdreiccysisckekdniditlqwliqhs

Sequence, based on observed residues (ATOM records):

>d2h18a1 c.37.1.0 (A:9-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldwfkalfwkeemeltlvglqysgkttfvnviasgqfnedminmrkitkgnvtiklwdig
gqprfrsmwerycrgvsaivymvdaadqekieasknelhnlldkpqlqgipvlvlgnkrd
lpgaldekeliekmnlsaiqdreiccysisckekdniditlqwliqhs

Timeline for d2h18a1:

• d2h18a1 first appeared in SCOPe 2.03, called d2h18a_
  
• d2h18a1 was called d2h18a_ in SCOPe 2.05
  
• d2h18a1 appears in SCOPe 2.07
  
• d2h18a1 appears in the current release, SCOPe 2.08