![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Anti-carbohydrate Fab S-20-4 (mouse), lambda L chain [48898] (3 PDB entries) |
![]() | Domain d1f4xl1: 1f4x L:1-110 [20450] Other proteins in same PDB: d1f4xh2, d1f4xl2 |
PDB Entry: 1f4x (more details), 2.3 Å
SCOP Domain Sequences for d1f4xl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f4xl1 b.1.1.1 (L:1-110) Immunoglobulin (variable domains of L and H chains) {Anti-carbohydrate Fab S-20-4 (mouse), lambda L chain} qavvtqesalttspgetvtltcrsstgtvttsnyanwvqekpdhlftgligatnnraagv pvrfsgsliggkaaltitgaqtedeaiyfcalwysghwvfgggtkltvlg
Timeline for d1f4xl1: