Lineage for d2h0jb_ (2h0j B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1772695Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1772955Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 1773528Family b.3.4.0: automated matches [191441] (1 protein)
    not a true family
  6. 1773529Protein automated matches [190651] (7 species)
    not a true protein
  7. 1773530Species Bacillus subtilis [TaxId:1423] [193190] (3 PDB entries)
  8. 1773536Domain d2h0jb_: 2h0j B: [204496]
    automated match to d2h0fb_
    complexed with urn

Details for d2h0jb_

PDB Entry: 2h0j (more details), 2.9 Å

PDB Description: crystal structure of pucm in the presence of 5,6-diaminouracil
PDB Compounds: (B:) Transthyretin-like protein pucM

SCOPe Domain Sequences for d2h0jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h0jb_ b.3.4.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
mgkltthildltcgkpaanvkiglkrlgesimkevytnndgrvdvpllageelmsgeyvm
efhagdyfasknmnaadqpfltivtvrfqladpdahyhiplllspfgyqvyrgs

SCOPe Domain Coordinates for d2h0jb_:

Click to download the PDB-style file with coordinates for d2h0jb_.
(The format of our PDB-style files is described here.)

Timeline for d2h0jb_: