| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) ![]() |
| Family b.3.4.0: automated matches [191441] (1 protein) not a true family |
| Protein automated matches [190651] (8 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [193190] (3 PDB entries) |
| Domain d2h0jb_: 2h0j B: [204496] automated match to d2h0fb_ complexed with urn |
PDB Entry: 2h0j (more details), 2.9 Å
SCOPe Domain Sequences for d2h0jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h0jb_ b.3.4.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
mgkltthildltcgkpaanvkiglkrlgesimkevytnndgrvdvpllageelmsgeyvm
efhagdyfasknmnaadqpfltivtvrfqladpdahyhiplllspfgyqvyrgs
Timeline for d2h0jb_: