Lineage for d2h0ja_ (2h0j A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1301408Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1301610Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 1302081Family b.3.4.0: automated matches [191441] (1 protein)
    not a true family
  6. 1302082Protein automated matches [190651] (6 species)
    not a true protein
  7. 1302083Species Bacillus subtilis [TaxId:1423] [193190] (3 PDB entries)
  8. 1302088Domain d2h0ja_: 2h0j A: [204495]
    automated match to d2h0fb_
    complexed with urn

Details for d2h0ja_

PDB Entry: 2h0j (more details), 2.9 Å

PDB Description: crystal structure of pucm in the presence of 5,6-diaminouracil
PDB Compounds: (A:) Transthyretin-like protein pucM

SCOPe Domain Sequences for d2h0ja_:

Sequence, based on SEQRES records: (download)

>d2h0ja_ b.3.4.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mgkltthildltcgkpaanvkiglkrlgesimkevytnndgrvdvpllageelmsgeyvm
efhagdyfasknmnaadqpfltivtvrfqladpdahyhiplllspfgyqvyrgs

Sequence, based on observed residues (ATOM records): (download)

>d2h0ja_ b.3.4.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mgkltthildltcgkpaanvkiglkrlgesimkevytnndgrvdvpllageelmsgeyvm
efhagdyfasknaadqpfltivtvrfqladpdahyhiplllspfgyqvyrgs

SCOPe Domain Coordinates for d2h0ja_:

Click to download the PDB-style file with coordinates for d2h0ja_.
(The format of our PDB-style files is described here.)

Timeline for d2h0ja_: