SCOPe 2.08: Domain d2h0ea_: 2h0e A:

Lineage for d2h0ea_ (2h0e A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.0: automated matches [191441] (1 protein)
   not a true family

6. Protein automated matches [190651] (8 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [193190] (3 PDB entries)

8. Domain d2h0ea_: 2h0e A: [204493]
   automated match to d2h0fb_
   complexed with gol

Details for d2h0ea_

PDB Entry: 2h0e, 2.2 Å

PDB Description: crystal structure of pucm in the absence of substrate

PDB Compounds: (A:) Transthyretin-like protein pucM

SCOPe Domain Sequences for d2h0ea_:

Sequence, based on SEQRES records:

>d2h0ea_ b.3.4.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mgkltthildltcgkpaanvkiglkrlgesimkevytnndgrvdvpllageelmsgeyvm
efhagdyfasknmnaadqpfltivtvrfqladpdahyhiplllspfgyqvyrgs

Sequence, based on observed residues (ATOM records):

>d2h0ea_ b.3.4.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mgkltthildltcgkpaanvkiglkrlgesimkevytnndgrvdvpllageelmsgeyvm
efhagdyfasknaadqpfltivtvrfqladpdahyhiplllspfgyqvyrgs

Timeline for d2h0ea_:

• d2h0ea_ first appeared in SCOPe 2.03
  
• d2h0ea_ appears in SCOPe 2.07