Lineage for d2h0bd_ (2h0b D:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1308009Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 1308035Protein Ligand-binding domain of neurexin 1beta [49949] (3 species)
  7. 1308036Species Cow (Bos taurus) [TaxId:9913] [225079] (1 PDB entry)
  8. 1308040Domain d2h0bd_: 2h0b D: [204492]
    automated match to d2r1di1
    complexed with ca, gol

Details for d2h0bd_

PDB Entry: 2h0b (more details), 2.1 Å

PDB Description: crystal structure of the second lns/lg domain from neurexin 1 alpha
PDB Compounds: (D:) Neurexin-1-alpha

SCOPe Domain Sequences for d2h0bd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h0bd_ b.29.1.4 (D:) Ligand-binding domain of neurexin 1beta {Cow (Bos taurus) [TaxId: 9913]}
keeyiatfkgseyfcydlsqnpiqsssdeitlsfktlqrnglmlhtgksadyvnlalkng
avslvinlgsgafealvepvngkfndnawhdvkvtrnlrqvtisvdgiltttgytqedyt
mlgsddffyvggspstadlpgspvsnnfmgclkevvyknndvrlelsrlakqgdpkmkih
gv

SCOPe Domain Coordinates for d2h0bd_:

Click to download the PDB-style file with coordinates for d2h0bd_.
(The format of our PDB-style files is described here.)

Timeline for d2h0bd_: