| Class b: All beta proteins [48724] (174 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
| Family b.29.1.4: Laminin G-like module [49944] (7 proteins) |
| Protein Ligand-binding domain of neurexin 1beta [49949] (3 species) |
| Species Cow (Bos taurus) [TaxId:9913] [225079] (1 PDB entry) |
| Domain d2h0bd_: 2h0b D: [204492] automated match to d2r1di1 complexed with ca, gol |
PDB Entry: 2h0b (more details), 2.1 Å
SCOPe Domain Sequences for d2h0bd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h0bd_ b.29.1.4 (D:) Ligand-binding domain of neurexin 1beta {Cow (Bos taurus) [TaxId: 9913]}
keeyiatfkgseyfcydlsqnpiqsssdeitlsfktlqrnglmlhtgksadyvnlalkng
avslvinlgsgafealvepvngkfndnawhdvkvtrnlrqvtisvdgiltttgytqedyt
mlgsddffyvggspstadlpgspvsnnfmgclkevvyknndvrlelsrlakqgdpkmkih
gv
Timeline for d2h0bd_: