SCOPe 2.05: Domain d2h0bb_: 2h0b B:

Lineage for d2h0bb_ (2h0b B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.4: Laminin G-like module [49944] (7 proteins)

6. Protein Ligand-binding domain of neurexin 1beta [49949] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [225079] (1 PDB entry)

8. Domain d2h0bb_: 2h0b B: [204490]
   automated match to d2r1di1
   complexed with ca, gol

Details for d2h0bb_

PDB Entry: 2h0b, 2.1 Å

PDB Description: crystal structure of the second lns/lg domain from neurexin 1 alpha

PDB Compounds: (B:) Neurexin-1-alpha

SCOPe Domain Sequences for d2h0bb_:

Sequence; same for both SEQRES and ATOM records:

>d2h0bb_ b.29.1.4 (B:) Ligand-binding domain of neurexin 1beta {Cow (Bos taurus) [TaxId: 9913]}
eeyiatfkgseyfcydlsqnpiqsssdeitlsfktlqrnglmlhtgksadyvnlalknga
vslvinlgsgafealvepvngkfndnawhdvkvtrnlrqvtisvdgiltttgytqedytm
lgsddffyvggspstadlpgspvsnnfmgclkevvyknndvrlelsrlakqgdpkmkihg
v

Timeline for d2h0bb_:

• d2h0bb_ first appeared in SCOPe 2.03
  
• d2h0bb_ appears in SCOPe 2.04
  
• d2h0bb_ appears in SCOPe 2.06
  
• d2h0bb_ appears in the current release, SCOPe 2.08