SCOP 1.75: Domain d1qnzh_: 1qnz H:

Lineage for d1qnzh_ (1qnz H:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (152 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E
   SQ NA # humanized antibody
   Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor
   Uniprot P01750 20-116 #
   HV06_MOUSE Ig heavy chain V region 102 precursor
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d1qnzh_: 1qnz H: [20449]
   Other proteins in same PDB: d1qnzl_
   part of anti-HIV Fv 0.5B

Details for d1qnzh_

PDB Entry: 1qnz

PDB Description: nmr structure of the 0.5b anti-hiv antibody complex with the gp120 v3 peptide

PDB Compounds: (H:) 0.5b antibody (heavy chain)

SCOP Domain Sequences for d1qnzh_:

Sequence; same for both SEQRES and ATOM records:

>d1qnzh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqsgaelvkpgasvkmsckasgytfttypiewmkqnhgkslewignfhpysddtny
nekfkgkakltvekssstvylefsrltsddsavyycaihygsayamdywgqgtsvtvss

Timeline for d1qnzh_:

• d1qnzh_ first appeared (with stable ids) in SCOP 1.55
  
• d1qnzh_ appears in SCOP 1.73
  
• d1qnzh_ appears in SCOPe 2.01
  
• d1qnzh_ appears in the current release, SCOPe 2.08