Lineage for d2h0ba_ (2h0b A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779532Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 2779558Protein Ligand-binding domain of neurexin 1beta [49949] (3 species)
  7. 2779559Species Cow (Bos taurus) [TaxId:9913] [225079] (1 PDB entry)
  8. 2779560Domain d2h0ba_: 2h0b A: [204489]
    Other proteins in same PDB: d2h0bc2
    automated match to d2r1di1
    complexed with ca, gol

Details for d2h0ba_

PDB Entry: 2h0b (more details), 2.1 Å

PDB Description: crystal structure of the second lns/lg domain from neurexin 1 alpha
PDB Compounds: (A:) Neurexin-1-alpha

SCOPe Domain Sequences for d2h0ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h0ba_ b.29.1.4 (A:) Ligand-binding domain of neurexin 1beta {Cow (Bos taurus) [TaxId: 9913]}
eeyiatfkgseyfcydlsqnpiqsssdeitlsfktlqrnglmlhtgksadyvnlalknga
vslvinlgsgafealvepvngkfndnawhdvkvtrnlrqvtisvdgiltttgytqedytm
lgsddffyvggspstadlpgspvsnnfmgclkevvyknndvrlelsrlakqgdpkmkihg
v

SCOPe Domain Coordinates for d2h0ba_:

Click to download the PDB-style file with coordinates for d2h0ba_.
(The format of our PDB-style files is described here.)

Timeline for d2h0ba_: