Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.4: Laminin G-like module [49944] (7 proteins) |
Protein Ligand-binding domain of neurexin 1beta [49949] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [225079] (1 PDB entry) |
Domain d2h0ba_: 2h0b A: [204489] Other proteins in same PDB: d2h0bc2 automated match to d2r1di1 complexed with ca, gol |
PDB Entry: 2h0b (more details), 2.1 Å
SCOPe Domain Sequences for d2h0ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h0ba_ b.29.1.4 (A:) Ligand-binding domain of neurexin 1beta {Cow (Bos taurus) [TaxId: 9913]} eeyiatfkgseyfcydlsqnpiqsssdeitlsfktlqrnglmlhtgksadyvnlalknga vslvinlgsgafealvepvngkfndnawhdvkvtrnlrqvtisvdgiltttgytqedytm lgsddffyvggspstadlpgspvsnnfmgclkevvyknndvrlelsrlakqgdpkmkihg v
Timeline for d2h0ba_:
View in 3D Domains from other chains: (mouse over for more information) d2h0bb_, d2h0bc1, d2h0bc2, d2h0bd_ |