Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (25 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225156] (13 PDB entries) |
Domain d2h08b1: 2h08 B:3-160 [204487] automated match to d2c4ka1 complexed with so4; mutant |
PDB Entry: 2h08 (more details), 2.5 Å
SCOPe Domain Sequences for d2h08b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h08b1 c.61.1.0 (B:3-160) automated matches {Human (Homo sapiens) [TaxId: 9606]} nikifsgsshqdlsqkiadrlglelgkvvtkkfsnqetcveigesvrgedvyivqsgcge indnlmelliminackiasasrvtavipcfpyarqdkkdksrapisaklvanmlsvagad hiitmdlhasqiqgffdipvdnlmaepavlkwirenis
Timeline for d2h08b1: