SCOPe 2.04: Domain d1qnzl_: 1qnz L:

Lineage for d1qnzl_ (1qnz L:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (28 PDB entries)

8. Domain d1qnzl_: 1qnz L: [20448]
   Other proteins in same PDB: d1qnzh_
   part of anti-HIV Fv 0.5B

Details for d1qnzl_

PDB Entry: 1qnz

PDB Description: nmr structure of the 0.5b anti-hiv antibody complex with the gp120 v3 peptide

PDB Compounds: (L:) 0.5b antibody (light chain)

SCOPe Domain Sequences for d1qnzl_:

Sequence; same for both SEQRES and ATOM records:

>d1qnzl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
divltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyaasnles
giparfsgsgsrtdftlnihpveeedaatyycqqsnedpftfgsgtkleikr

Timeline for d1qnzl_:

• d1qnzl_ first appeared (with stable ids) in SCOP 1.55
  
• d1qnzl_ appears in SCOPe 2.03
  
• d1qnzl_ appears in SCOPe 2.05
  
• d1qnzl_ appears in the current release, SCOPe 2.08, called d1qnzl1